SLC27A4 Antikörper
-
- Target Alle SLC27A4 Antikörper anzeigen
- SLC27A4 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 4 (SLC27A4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC27A4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC27 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
- Top Product
- Discover our top product SLC27A4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC27A4 Blocking Peptide, catalog no. 33R-10148, is also available for use as a blocking control in assays to test for specificity of this SLC27A4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC27A4 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 4 (SLC27A4))
- Andere Bezeichnung
- SLC27A4 (SLC27A4 Produkte)
- Synonyme
- SLC27A4 antikoerper, zgc:112138 antikoerper, FATP4 antikoerper, ACSVL4 antikoerper, IPS antikoerper, BB144259 antikoerper, Fatp4 antikoerper, solute carrier family 27 member 4 antikoerper, solute carrier family 27 (fatty acid transporter), member 4 antikoerper, SLC27A4 antikoerper, slc27a4 antikoerper, Slc27a4 antikoerper
- Hintergrund
- SLC27A4 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. It appears to be the principal fatty acid transporter in small intestinal enterocytes. SLC27A4 plays a role in the formation of the epidermal barrier. It is required for fat absorption in early embryogenesis. SLC27A4 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.
- Molekulargewicht
- 72 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-