GZMK Antikörper
-
- Target Alle GZMK Antikörper anzeigen
- GZMK (Granzyme K (Granzyme 3, Tryptase II) (GZMK))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GZMK Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Granzyme K antibody was raised using a synthetic peptide corresponding to a region with amino acids PTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAK
- Top Product
- Discover our top product GZMK Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Granzyme K Blocking Peptide, catalog no. 33R-7402, is also available for use as a blocking control in assays to test for specificity of this Granzyme K antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMK antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GZMK (Granzyme K (Granzyme 3, Tryptase II) (GZMK))
- Andere Bezeichnung
- Granzyme K (GZMK Produkte)
- Synonyme
- TRYP2 antikoerper, granzyme K antikoerper, GZMK antikoerper, Gzmk antikoerper
- Hintergrund
- GZMK is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes.
- Molekulargewicht
- 26 kDa (MW of target protein)
-