MMP16 Antikörper

Produktnummer ABIN635772

Produktdetails anti-MMP16 Antikörper

Target: MMP16 (Matrix Metallopeptidase 16 (Membrane-inserted) (MMP16))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMP16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MMP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MMP16 Blocking Peptide, catalog no. 33R-1318, is also available for use as a blocking control in assays to test for specificity of this MMP16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMP16

Target: MMP16 (Matrix Metallopeptidase 16 (Membrane-inserted) (MMP16))

Andere Bezeichnung: MMP16 (MMP16 Produkte)

Synonyme: MT3-MMP antikoerper, Mt3mmp antikoerper, Mt3-mmp antikoerper, C8orf57 antikoerper, MMP-X2 antikoerper, MT-MMP2 antikoerper, MT-MMP3 antikoerper, matrix metallopeptidase 16 antikoerper, Mmp16 antikoerper, MMP16 antikoerper

Hintergrund: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases.

Molekulargewicht: 56 kDa (MW of target protein)