CJ057 Antikörper (Middle Region)

Produktnummer ABIN635765

Produktdetails anti-CJ057 Antikörper

Target: CJ057 (C10ORF57) (Chromosome 10 Open Reading Frame 57 (C10ORF57))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CJ057 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C10 ORF57 antibody was raised against the middle region of C10 rf57

Aufreinigung: Affinity purified

Immunogen: C10 ORF57 antibody was raised using the middle region of C10 rf57 corresponding to a region with amino acids QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C10ORF57 Blocking Peptide, catalog no. 33R-7727, is also available for use as a blocking control in assays to test for specificity of this C10ORF57 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF57 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CJ057

Target: CJ057 (C10ORF57) (Chromosome 10 Open Reading Frame 57 (C10ORF57))

Andere Bezeichnung: C10ORF57 (C10ORF57 Produkte)

Synonyme: MGC131362 antikoerper, C10orf57 antikoerper, bA369J21.6 antikoerper, transmembrane protein 254 antikoerper, transmembrane protein 254 L homeolog antikoerper, TMEM254 antikoerper, tmem254 antikoerper, tmem254.L antikoerper

Hintergrund: C10orf57 encodes a transmembrane protein.

Molekulargewicht: 14 kDa (MW of target protein)