TSPAN12 Antikörper (Middle Region)
-
- Target Alle TSPAN12 Antikörper anzeigen
- TSPAN12 (Tetraspanin 12 (TSPAN12))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TSPAN12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Tetraspanin 12 antibody was raised against the middle region of TSPAN12
- Aufreinigung
- Affinity purified
- Immunogen
- Tetraspanin 12 antibody was raised using the middle region of TSPAN12 corresponding to a region with amino acids DSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGI
- Top Product
- Discover our top product TSPAN12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Tetraspanin 12 Blocking Peptide, catalog no. 33R-2156, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSPAN12 (Tetraspanin 12 (TSPAN12))
- Andere Bezeichnung
- Tetraspanin 12 (TSPAN12 Produkte)
- Synonyme
- tm4sf12 antikoerper, zgc:63880 antikoerper, EVR5 antikoerper, NET-2 antikoerper, NET2 antikoerper, TM4SF12 antikoerper, 9030619E17 antikoerper, AI426782 antikoerper, AI663988 antikoerper, AW111457 antikoerper, Tm4sf12 antikoerper, tetraspanin-7 antikoerper, tetraspanin 12 antikoerper, LOC412465 antikoerper, TSPAN12 antikoerper, tspan12 antikoerper, Tspan12 antikoerper
- Hintergrund
- TSPAN12 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
- Molekulargewicht
- 35 kDa (MW of target protein)
-