Tetraspanin 3 Antikörper (Middle Region)

Produktnummer ABIN635759

Produktdetails anti-Tetraspanin 3 Antikörper

Target: Tetraspanin 3 (TSPAN3)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tetraspanin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Tetraspanin 3 antibody was raised against the middle region of TSPAN3

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 3 antibody was raised using the middle region of TSPAN3 corresponding to a region with amino acids SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 3 Blocking Peptide, catalog no. 33R-8740, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tetraspanin 3

Target: Tetraspanin 3 (TSPAN3)

Andere Bezeichnung: Tetraspanin 3 (TSPAN3 Produkte)

Synonyme: tm4-a antikoerper, tm4sf8 antikoerper, tspan-3 antikoerper, fj34d08 antikoerper, si:dkey-24l11.4 antikoerper, wu:fj34d08 antikoerper, zgc:114050 antikoerper, DKFZp469M0635 antikoerper, TM4-A antikoerper, TM4SF8 antikoerper, TSPAN-3 antikoerper, 1700055K04Rik antikoerper, Tm4sf8 antikoerper, tetraspanin 3 antikoerper, tetraspanin 3a antikoerper, tetraspanin 3 S homeolog antikoerper, TSPAN3 antikoerper, tspan3 antikoerper, tspan3a antikoerper, tspan3.S antikoerper, Tspan3 antikoerper

Hintergrund: TSPAN3 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Molekulargewicht: 25 kDa (MW of target protein)