Tetraspanin 3 Antikörper (Middle Region)

Produktnummer ABIN635759

Der Kaninchen Polyklonal anti-Tetraspanin 3 Antikörper wird verwendet zum Nachweis von Tetraspanin 3 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für Tetraspanin 3 Antikörper (Middle Region) (ABIN635759)

Target: Tetraspanin 3 (TSPAN3)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tetraspanin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Tetraspanin 3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Tetraspanin 3 antibody was raised against the middle region of TSPAN3

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 3 antibody was raised using the middle region of TSPAN3 corresponding to a region with amino acids SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 3 Blocking Peptide, (ABIN5616557), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tetraspanin 3

Target: Tetraspanin 3 (TSPAN3)

Andere Bezeichnung: Tetraspanin 3

Hintergrund: TSPAN3 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Molekulargewicht: 25 kDa (MW of target protein)