CHST13 Antikörper
-
- Target Alle CHST13 Antikörper anzeigen
- CHST13 (Carbohydrate (Chondroitin 4) Sulfotransferase 13 (CHST13))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHST13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CHST13 antibody was raised using a synthetic peptide corresponding to a region with amino acids CHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDL
- Top Product
- Discover our top product CHST13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHST13 Blocking Peptide, catalog no. 33R-1710, is also available for use as a blocking control in assays to test for specificity of this CHST13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHST13 (Carbohydrate (Chondroitin 4) Sulfotransferase 13 (CHST13))
- Andere Bezeichnung
- CHST13 (CHST13 Produkte)
- Synonyme
- C4ST3 antikoerper, carbohydrate sulfotransferase 13 antikoerper, CHST13 antikoerper
- Hintergrund
- CHST13 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-