DNASE2B Antikörper (Middle Region)
-
- Target Alle DNASE2B Antikörper anzeigen
- DNASE2B (Deoxyribonuclease II beta (DNASE2B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DNASE2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DNASE2 B antibody was raised against the middle region of DNASE2
- Aufreinigung
- Affinity purified
- Immunogen
- DNASE2 B antibody was raised using the middle region of DNASE2 corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG
- Top Product
- Discover our top product DNASE2B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DNASE2B Blocking Peptide, catalog no. 33R-4011, is also available for use as a blocking control in assays to test for specificity of this DNASE2B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNASE2B (Deoxyribonuclease II beta (DNASE2B))
- Andere Bezeichnung
- DNASE2B (DNASE2B Produkte)
- Synonyme
- DNASE2 antikoerper, deoxyribonuclease-2-beta antikoerper, DLAD antikoerper, DNASE2B antikoerper, dnase2b antikoerper, AI526873 antikoerper, Dlad antikoerper, DnaseIIb antikoerper, UOX antikoerper, deoxyribonuclease 2 beta antikoerper, deoxyribonuclease II beta antikoerper, DNASE2B antikoerper, dnase2b antikoerper, Dnase2b antikoerper
- Hintergrund
- DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs. The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II.
- Molekulargewicht
- 39 kDa (MW of target protein)
-