NKAIN1 Antikörper (Middle Region)

Produktnummer ABIN635733

Produktdetails anti-NKAIN1 Antikörper

Target: NKAIN1 (Na+/K+ Transporting ATPase Interacting 1 (NKAIN1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NKAIN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NKAIN1 antibody was raised against the middle region of NKAIN1

Aufreinigung: Affinity purified

Immunogen: NKAIN1 antibody was raised using the middle region of NKAIN1 corresponding to a region with amino acids TPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NKAIN1 Blocking Peptide, catalog no. 33R-9236, is also available for use as a blocking control in assays to test for specificity of this NKAIN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKAIN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NKAIN1

Target: NKAIN1 (Na+/K+ Transporting ATPase Interacting 1 (NKAIN1))

Andere Bezeichnung: NKAIN1 (NKAIN1 Produkte)

Synonyme: FAM77C antikoerper, 2610200G18Rik antikoerper, 2810426C15Rik antikoerper, RGD1561205 antikoerper, fam77c antikoerper, sodium/potassium transporting ATPase interacting 1 antikoerper, Na+/K+ transporting ATPase interacting 1 antikoerper, Sodium/potassium transporting ATPase interacting 1 antikoerper, Na+/K+ transporting ATPase interacting 1 L homeolog antikoerper, NKAIN1 antikoerper, Nkain1 antikoerper, nkain1.L antikoerper

Hintergrund: It belongs to the NKAIN family. The exact function of NKAIN1 remains unknown.

Molekulargewicht: 18 kDa (MW of target protein)