ABCA12 Antikörper

Produktnummer ABIN635729

Produktdetails anti-ABCA12 Antikörper

Target: ABCA12 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 12 (ABCA12))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCA12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCA12 Blocking Peptide, catalog no. 33R-9318, is also available for use as a blocking control in assays to test for specificity of this ABCA12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCA12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCA12

Target: ABCA12 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 12 (ABCA12))

Andere Bezeichnung: ABCA12 (ABCA12 Produkte)

Synonyme: cb352 antikoerper, sb:cb352 antikoerper, ARCI4A antikoerper, ARCI4B antikoerper, ICR2B antikoerper, LI2 antikoerper, 4832428G11Rik antikoerper, 4833417A11Rik antikoerper, ATP binding cassette subfamily A member 12 antikoerper, ATP-binding cassette, sub-family A (ABC1), member 12 antikoerper, ABCA12 antikoerper, abca12 antikoerper, Abca12 antikoerper

Hintergrund: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes.

Molekulargewicht: 257 kDa (MW of target protein)