PTPRH Antikörper (Middle Region)

Produktnummer ABIN635715

Produktdetails anti-PTPRH Antikörper

Target: PTPRH (Protein tyrosine Phosphatase, Receptor Type, H (PTPRH))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTPRH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTPRH antibody was raised against the middle region of PTPRH

Aufreinigung: Affinity purified

Immunogen: PTPRH antibody was raised using the middle region of PTPRH corresponding to a region with amino acids QTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTPRH Blocking Peptide, catalog no. 33R-7755, is also available for use as a blocking control in assays to test for specificity of this PTPRH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTPRH

Target: PTPRH (Protein tyrosine Phosphatase, Receptor Type, H (PTPRH))

Andere Bezeichnung: PTPRH (PTPRH Produkte)

Synonyme: SAP-1 antikoerper, si:dkey-197c15.5 antikoerper, SAP1 antikoerper, sap-1 antikoerper, Bem2 antikoerper, protein tyrosine phosphatase, receptor type, h antikoerper, protein tyrosine phosphatase, receptor type H antikoerper, protein tyrosine phosphatase, receptor type, H antikoerper, ptprh antikoerper, PTPRH antikoerper, Ptprh antikoerper

Hintergrund: PTPRH is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracytoplasmic catalytic domain, and thus represents a receptor-type PTP. The extracellular region contains eight fibronectin type III-like repeats and multiple N-glycosylation sites. It was also found to be expressed in several cancer cell lines, but not in the corresponding normal tissues.

Molekulargewicht: 120 kDa (MW of target protein)