Reticulon 4 Antikörper (Middle Region)
-
- Target Alle Reticulon 4 (RTN4) Antikörper anzeigen
- Reticulon 4 (RTN4)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Reticulon 4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RTN4 antibody was raised against the middle region of RTN4
- Aufreinigung
- Affinity purified
- Immunogen
- RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI
- Top Product
- Discover our top product RTN4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RTN4 Blocking Peptide, catalog no. 33R-3051, is also available for use as a blocking control in assays to test for specificity of this RTN4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Reticulon 4 (RTN4)
- Andere Bezeichnung
- RTN4 (RTN4 Produkte)
- Synonyme
- ASY antikoerper, NI220/250 antikoerper, NOGO antikoerper, NOGO-A antikoerper, NOGOC antikoerper, NSP antikoerper, NSP-CL antikoerper, Nbla00271 antikoerper, Nbla10545 antikoerper, Nogo-B antikoerper, Nogo-C antikoerper, RTN-X antikoerper, RTN4-A antikoerper, RTN4-B1 antikoerper, RTN4-B2 antikoerper, RTN4-C antikoerper, RTN4-Cw antikoerper, DKFZp459C0314 antikoerper, 1110020G17Rik antikoerper, AA407876 antikoerper, AA409940 antikoerper, AA960376 antikoerper, C130026I10Rik antikoerper, NgA antikoerper, Nogo-A antikoerper, mKIAA0886 antikoerper, mKIAA4153 antikoerper, NI-250 antikoerper, Nogo antikoerper, Vp20 antikoerper, r antikoerper, rat N antikoerper, rat NogoA antikoerper, reticulon-4 antikoerper, nogo antikoerper, rtn4 antikoerper, wu:fb17a02 antikoerper, wu:fb22f12 antikoerper, wu:fd61a07 antikoerper, zgc:92163 antikoerper, reticulon 4 antikoerper, reticulon 4a antikoerper, RTN4 antikoerper, rtn4 antikoerper, Rtn4 antikoerper, rtn4a antikoerper
- Hintergrund
- RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- Neurotrophin Signalübertragung, Regulation of Cell Size, SARS-CoV-2 Protein Interaktom
-