Reticulon 4 Antikörper (Middle Region)

Produktnummer ABIN635710

Produktdetails anti-Reticulon 4 Antikörper

Target: Reticulon 4 (RTN4)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Reticulon 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RTN4 antibody was raised against the middle region of RTN4

Aufreinigung: Affinity purified

Immunogen: RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RTN4 Blocking Peptide, catalog no. 33R-7833, is also available for use as a blocking control in assays to test for specificity of this RTN4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Reticulon 4

Target: Reticulon 4 (RTN4)

Andere Bezeichnung: RTN4 (RTN4 Produkte)

Synonyme: ASY antikoerper, NI220/250 antikoerper, NOGO antikoerper, NOGO-A antikoerper, NOGOC antikoerper, NSP antikoerper, NSP-CL antikoerper, Nbla00271 antikoerper, Nbla10545 antikoerper, Nogo-B antikoerper, Nogo-C antikoerper, RTN-X antikoerper, RTN4-A antikoerper, RTN4-B1 antikoerper, RTN4-B2 antikoerper, RTN4-C antikoerper, RTN4-Cw antikoerper, DKFZp459C0314 antikoerper, 1110020G17Rik antikoerper, AA407876 antikoerper, AA409940 antikoerper, AA960376 antikoerper, C130026I10Rik antikoerper, NgA antikoerper, Nogo-A antikoerper, mKIAA0886 antikoerper, mKIAA4153 antikoerper, NI-250 antikoerper, Nogo antikoerper, Vp20 antikoerper, r antikoerper, rat N antikoerper, rat NogoA antikoerper, reticulon-4 antikoerper, nogo antikoerper, rtn4 antikoerper, wu:fb17a02 antikoerper, wu:fb22f12 antikoerper, wu:fd61a07 antikoerper, zgc:92163 antikoerper, reticulon 4 antikoerper, reticulon 4a antikoerper, RTN4 antikoerper, rtn4 antikoerper, Rtn4 antikoerper, rtn4a antikoerper

Hintergrund: RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung, Regulation of Cell Size, SARS-CoV-2 Protein Interaktom