UGT8 Antikörper (Middle Region)

Produktnummer ABIN635705

Produktdetails anti-UGT8 Antikörper

Target: UGT8 (UDP Glycosyltransferase 8 (UGT8))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGT8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGT8 antibody was raised against the middle region of µgT8

Aufreinigung: Affinity purified

Immunogen: UGT8 antibody was raised using the middle region of µgT8 corresponding to a region with amino acids GILLEWKTVTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGT8 Blocking Peptide, catalog no. 33R-3336, is also available for use as a blocking control in assays to test for specificity of this µgT8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGT8

Target: UGT8 (UDP Glycosyltransferase 8 (UGT8))

Andere Bezeichnung: UGT8 (UGT8 Produkte)

Synonyme: Xlcgt antikoerper, cgt antikoerper, ugt4 antikoerper, AI850488 antikoerper, AW455908 antikoerper, Cgt antikoerper, Ugt8 antikoerper, mCerGT antikoerper, CGT antikoerper, UGT4 antikoerper, Ugt8a antikoerper, UDP glycosyltransferase 8 antikoerper, UDP galactosyltransferase 8A antikoerper, UGT8 antikoerper, ugt8 antikoerper, Ugt8a antikoerper, Ugt8 antikoerper

Hintergrund: Galactocerebrosides are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system and are also present in small amounts in kidney. The key enzymatic step in the biosynthesis of galactocerebrosides consists of the transfer of galactose to ceramide catalyzed by UDP-galactose ceramide galactosyltransferase. The enzyme UGT8 is the first involved in complex lipid biosynthesis in the myelinating oligodendrocyte.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization