SEMA6D Antikörper (N-Term)

Produktnummer ABIN635700

Produktdetails anti-SEMA6D Antikörper

Target: SEMA6D (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6D (SEMA6D))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEMA6D Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SEMA6 D antibody was raised against the N terminal of SEMA6

Aufreinigung: Affinity purified

Immunogen: SEMA6 D antibody was raised using the N terminal of SEMA6 corresponding to a region with amino acids KLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SEMA6D Blocking Peptide, catalog no. 33R-4550, is also available for use as a blocking control in assays to test for specificity of this SEMA6D antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEMA6D

Target: SEMA6D (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6D (SEMA6D))

Andere Bezeichnung: SEMA6D (SEMA6D Produkte)

Synonyme: 1110067B02Rik antikoerper, AA409156 antikoerper, D330011G23 antikoerper, Sema6D-1 antikoerper, Sema6D-2 antikoerper, Sema6D-4 antikoerper, Sema6D-5 antikoerper, Sema6D-6 antikoerper, mKIAA1479 antikoerper, wu:fi06a12 antikoerper, wu:fi76a10 antikoerper, zgc:56170 antikoerper, semaphorin 6D antikoerper, sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D antikoerper, semaphorin 6D L homeolog antikoerper, SEMA6D antikoerper, Sema6d antikoerper, sema6d antikoerper, sema6d.L antikoerper

Hintergrund: Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration