CHST8 Antikörper

Produktnummer ABIN635699

Produktdetails anti-CHST8 Antikörper

Target: CHST8 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 8 (CHST8))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHST8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CHST8 antibody was raised using a synthetic peptide corresponding to a region with amino acids GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHST8 Blocking Peptide, catalog no. 33R-3192, is also available for use as a blocking control in assays to test for specificity of this CHST8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHST8

Target: CHST8 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 8 (CHST8))

Andere Bezeichnung: CHST8 (CHST8 Produkte)

Synonyme: MGC146666 antikoerper, GALNAC4ST1 antikoerper, GalNAc4ST antikoerper, 1500011J21Rik antikoerper, AI426009 antikoerper, carbohydrate sulfotransferase 8 antikoerper, carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8 antikoerper, CHST8 antikoerper, chst8 antikoerper, Chst8 antikoerper

Hintergrund: Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates.

Molekulargewicht: 49 kDa (MW of target protein)