SMPD1 Antikörper (Middle Region)
-
- Target Alle SMPD1 Antikörper anzeigen
- SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SMPD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SMPD1 antibody was raised against the middle region of SMPD1
- Aufreinigung
- Affinity purified
- Immunogen
- SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV
- Top Product
- Discover our top product SMPD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SMPD1 Blocking Peptide, catalog no. 33R-4082, is also available for use as a blocking control in assays to test for specificity of this SMPD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))
- Andere Bezeichnung
- SMPD1 (SMPD1 Produkte)
- Synonyme
- ASM antikoerper, ASMASE antikoerper, NPD antikoerper, A-SMase antikoerper, Zn-SMase antikoerper, aSMase antikoerper, SMPD1 antikoerper, sphingomyelin phosphodiesterase 1 antikoerper, sphingomyelin phosphodiesterase 1, acid lysosomal antikoerper, sphingomyelin phosphodiesterase antikoerper, SMPD1 antikoerper, Smpd1 antikoerper, LOC5578088 antikoerper
- Hintergrund
- SMPD1 is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB).
- Molekulargewicht
- 65 kDa (MW of target protein)
-