SMPD1 Antikörper (Middle Region)

Produktnummer ABIN635693

Der Kaninchen Polyklonal anti-SMPD1 Antikörper wird verwendet zum Nachweis von SMPD1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für SMPD1 Antikörper (Middle Region) (ABIN635693)

Target: SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMPD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SMPD1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SMPD1 antibody was raised against the middle region of SMPD1

Aufreinigung: Affinity purified

Immunogen: SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMPD1 Blocking Peptide, (ABIN939468), is also available for use as a blocking control in assays to test for specificity of this SMPD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMPD1

Target: SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))

Andere Bezeichnung: SMPD1

Hintergrund: SMPD1 is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB).

Molekulargewicht: 65 kDa (MW of target protein)