LRCH4 Antikörper
-
- Target Alle LRCH4 Antikörper anzeigen
- LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRCH4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLMTQLRQVLESRLQRPLPEDLAEALASGVILCQLANQLRPRSVPFIHVP
- Top Product
- Discover our top product LRCH4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRCH4 Blocking Peptide, catalog no. 33R-2059, is also available for use as a blocking control in assays to test for specificity of this LRCH4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRCH4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))
- Andere Bezeichnung
- LRCH4 (LRCH4 Produkte)
- Synonyme
- LRN antikoerper, LRRN1 antikoerper, LRRN4 antikoerper, PP14183 antikoerper, 2810008P14Rik antikoerper, 2900069C24Rik antikoerper, AI558103 antikoerper, SAP25 antikoerper, mFLJ00248 antikoerper, si:dkeyp-73c8.2 antikoerper, leucine rich repeats and calponin homology domain containing 4 antikoerper, leucine-rich repeats and calponin homology (CH) domain containing 4 antikoerper, LRCH4 antikoerper, Lrch4 antikoerper, lrch4 antikoerper
- Hintergrund
- This gene encodes a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that the encoded protein resembles a receptor.
- Molekulargewicht
- 73 kDa (MW of target protein)
-