GPR161 Antikörper (Middle Region)
-
- Target Alle GPR161 Antikörper anzeigen
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPR161 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- GPR161 antibody was raised against the middle region of GPR161
- Aufreinigung
- Affinity purified
- Immunogen
- GPR161 antibody was raised using the middle region of GPR161 corresponding to a region with amino acids FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG
- Top Product
- Discover our top product GPR161 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPR161 Blocking Peptide, catalog no. 33R-2995, is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR161 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
- Andere Bezeichnung
- GPR161 (GPR161 Produkte)
- Synonyme
- RE2 antikoerper, Gm208 antikoerper, Gm208Gpr antikoerper, vl antikoerper, RGD1563245 antikoerper, si:bz20i5.4 antikoerper, si:rp71-20i5.4 antikoerper, G protein-coupled receptor 161 antikoerper, GPR161 antikoerper, Gpr161 antikoerper, gpr161 antikoerper
- Hintergrund
- GPR161 is Orphan receptor.
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-