GPR161 Antikörper (Middle Region)

Produktnummer ABIN635640

Der Kaninchen Polyklonal anti-GPR161 Antikörper (ABIN635640) detektiert spezifisch GPR161 in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für GPR161 Antikörper (Middle Region) (ABIN635640)

Target: GPR161 (G Protein-Coupled Receptor 161 (GPR161))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPR161 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-GPR161 Antikörper

Bindungsspezifität: Middle Region

Spezifität: GPR161 antibody was raised against the middle region of GPR161

Aufreinigung: Affinity purified

Immunogen: GPR161 antibody was raised using the middle region of GPR161 corresponding to a region with amino acids FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPR161 Blocking Peptide, (ABIN938381), is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR161 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPR161

Target: GPR161 (G Protein-Coupled Receptor 161 (GPR161))

Andere Bezeichnung: GPR161

Hintergrund: GPR161 is Orphan receptor.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: cAMP Metabolic Process