ZP1 Antikörper

Produktnummer ABIN635633

Produktdetails anti-ZP1 Antikörper

Target: ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ZP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZP1 Blocking Peptide, catalog no. 33R-9168, is also available for use as a blocking control in assays to test for specificity of this ZP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZP1

Target: ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))

Andere Bezeichnung: ZP1 (ZP1 Produkte)

Synonyme: zona pellucida glycoprotein 1 (sperm receptor) antikoerper, zona pellucida glycoprotein 1 antikoerper, ZP1 antikoerper, Zp1 antikoerper

Hintergrund: The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.

Molekulargewicht: 70 kDa (MW of target protein)