GHRHR Antikörper (C-Term)
-
- Target Alle GHRHR Antikörper anzeigen
- GHRHR (Growth Hormone Releasing Hormone Receptor (GHRHR))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GHRHR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GHRHR antibody was raised against the C terminal of GHRHR
- Aufreinigung
- Affinity purified
- Immunogen
- GHRHR antibody was raised using the C terminal of GHRHR corresponding to a region with amino acids YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV
- Top Product
- Discover our top product GHRHR Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GHRHR Blocking Peptide, catalog no. 33R-10294, is also available for use as a blocking control in assays to test for specificity of this GHRHR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GHRHR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GHRHR (Growth Hormone Releasing Hormone Receptor (GHRHR))
- Andere Bezeichnung
- GHRHR (GHRHR Produkte)
- Synonyme
- GHRFR antikoerper, GRFR antikoerper, IGHD1B antikoerper, Ghrfr antikoerper, lit antikoerper, little antikoerper, GHRHREC antikoerper, GHRH-R antikoerper, growth hormone releasing hormone receptor antikoerper, GHRHR antikoerper, Ghrhr antikoerper
- Hintergrund
- GHRHR is a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in its gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Hormone Transport, Regulation of Intracellular Steroid Hormone Receptor Signaling, cAMP Metabolic Process
-