SYT9 Antikörper (Middle Region)

Produktnummer ABIN635624

Produktdetails anti-SYT9 Antikörper

Target: SYT9 (Synaptotagmin IX (SYT9))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SYT9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SYT9 antibody was raised against the middle region of SYT9

Aufreinigung: Affinity purified

Immunogen: SYT9 antibody was raised using the middle region of SYT9 corresponding to a region with amino acids PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SYT9 Blocking Peptide, catalog no. 33R-7008, is also available for use as a blocking control in assays to test for specificity of this SYT9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYT9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SYT9

Target: SYT9 (Synaptotagmin IX (SYT9))

Andere Bezeichnung: SYT9 (SYT9 Produkte)

Synonyme: Sytv antikoerper, zgc:91875 antikoerper, synaptotagmin IX antikoerper, synaptotagmin 9 antikoerper, synaptotagmin IXb antikoerper, Syt9 antikoerper, SYT9 antikoerper, syt9 antikoerper, syt9b antikoerper

Hintergrund: SYT9 may be involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain or may serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis.

Molekulargewicht: 56 kDa (MW of target protein)