SYT9 Antikörper (Middle Region)
-
- Target Alle SYT9 Antikörper anzeigen
- SYT9 (Synaptotagmin IX (SYT9))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SYT9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SYT9 antibody was raised against the middle region of SYT9
- Aufreinigung
- Affinity purified
- Immunogen
- SYT9 antibody was raised using the middle region of SYT9 corresponding to a region with amino acids PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL
- Top Product
- Discover our top product SYT9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SYT9 Blocking Peptide, catalog no. 33R-7008, is also available for use as a blocking control in assays to test for specificity of this SYT9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYT9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SYT9 (Synaptotagmin IX (SYT9))
- Andere Bezeichnung
- SYT9 (SYT9 Produkte)
- Synonyme
- Sytv antikoerper, zgc:91875 antikoerper, synaptotagmin IX antikoerper, synaptotagmin 9 antikoerper, synaptotagmin IXb antikoerper, Syt9 antikoerper, SYT9 antikoerper, syt9 antikoerper, syt9b antikoerper
- Hintergrund
- SYT9 may be involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain or may serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis.
- Molekulargewicht
- 56 kDa (MW of target protein)
-