MTUS1 Antikörper (Middle Region)
-
- Target Alle MTUS1 Antikörper anzeigen
- MTUS1 (Microtubule Associated Tumor Suppressor 1 (MTUS1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTUS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MTUS1 antibody was raised against the middle region of MTUS1
- Aufreinigung
- Affinity purified
- Immunogen
- MTUS1 antibody was raised using the middle region of MTUS1 corresponding to a region with amino acids KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR
- Top Product
- Discover our top product MTUS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MTUS1 Blocking Peptide, catalog no. 33R-4631, is also available for use as a blocking control in assays to test for specificity of this MTUS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTUS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTUS1 (Microtubule Associated Tumor Suppressor 1 (MTUS1))
- Andere Bezeichnung
- MTUS1 (MTUS1 Produkte)
- Synonyme
- ATBP antikoerper, ATIP antikoerper, ICIS antikoerper, MP44 antikoerper, MTSG1 antikoerper, AI481402 antikoerper, ATBP135 antikoerper, Atip1 antikoerper, B430010I23Rik antikoerper, B430305I03Rik antikoerper, C85752 antikoerper, Cctsg1-440 antikoerper, MD44 antikoerper, mKIAA1288 antikoerper, ATIP4 antikoerper, Atip3b antikoerper, Mtsg1 antikoerper, fbx27 antikoerper, fa17d11 antikoerper, wu:fa17d11 antikoerper, wu:fi18f08 antikoerper, zgc:154168 antikoerper, microtubule associated scaffold protein 1 antikoerper, mitochondrial tumor suppressor 1 antikoerper, microtubule associated scaffold protein 1 L homeolog antikoerper, microtubule associated tumor suppressor 1 antikoerper, microtubule associated tumor suppressor 1a antikoerper, MTUS1 antikoerper, Mtus1 antikoerper, mtus1.L antikoerper, mtus1a antikoerper
- Hintergrund
- MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.
- Molekulargewicht
- 141 kDa (MW of target protein)
-