IQCF1 Antikörper (Middle Region)

Produktnummer ABIN635588

Produktdetails anti-IQCF1 Antikörper

Target: IQCF1 (IQ Motif Containing F1 (IQCF1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IQCF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IQCF1 antibody was raised against the middle region of IQCF1

Aufreinigung: Affinity purified

Immunogen: IQCF1 antibody was raised using the middle region of IQCF1 corresponding to a region with amino acids ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IQCF1 Blocking Peptide, catalog no. 33R-1560, is also available for use as a blocking control in assays to test for specificity of this IQCF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IQCF1

Target: IQCF1 (IQ Motif Containing F1 (IQCF1))

Andere Bezeichnung: IQCF1 (IQCF1 Produkte)

Synonyme: 1700055J15Rik antikoerper, IQ motif containing F1 antikoerper, IQCF1 antikoerper, Iqcf1 antikoerper

Hintergrund: The exact function of IQCF1 is not known.

Molekulargewicht: 24 kDa (MW of target protein)