IQCF1 Antikörper (Middle Region)
-
- Target Alle IQCF1 Produkte
- IQCF1 (IQ Motif Containing F1 (IQCF1))
-
Bindungsspezifität
- Middle Region
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IQCF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IQCF1 antibody was raised against the middle region of IQCF1
- Aufreinigung
- Affinity purified
- Immunogen
- IQCF1 antibody was raised using the middle region of IQCF1 corresponding to a region with amino acids ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IQCF1 Blocking Peptide, catalog no. 33R-1560, is also available for use as a blocking control in assays to test for specificity of this IQCF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IQCF1 (IQ Motif Containing F1 (IQCF1))
- Andere Bezeichnung
- IQCF1 (IQCF1 Produkte)
- Synonyme
- 1700055J15Rik antikoerper, IQ motif containing F1 antikoerper, IQCF1 antikoerper, Iqcf1 antikoerper
- Hintergrund
- The exact function of IQCF1 is not known.
- Molekulargewicht
- 24 kDa (MW of target protein)
-