ZDHHC24 Antikörper (N-Term)

Produktnummer ABIN635580

Produktdetails anti-ZDHHC24 Antikörper

Target: ZDHHC24 (Zinc Finger, DHHC-Type Containing 24 (ZDHHC24))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZDHHC24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZDHHC24 antibody was raised against the N terminal of ZDHHC24

Aufreinigung: Affinity purified

Immunogen: ZDHHC24 antibody was raised using the N terminal of ZDHHC24 corresponding to a region with amino acids YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVML

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZDHHC24 Blocking Peptide, catalog no. 33R-10279, is also available for use as a blocking control in assays to test for specificity of this ZDHHC24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZDHHC24

Target: ZDHHC24 (Zinc Finger, DHHC-Type Containing 24 (ZDHHC24))

Andere Bezeichnung: ZDHHC24 (ZDHHC24 Produkte)

Synonyme: zgc:91907 antikoerper, wu:fe02b01 antikoerper, 5730496N17Rik antikoerper, Leng4 antikoerper, zinc finger, DHHC-type containing 24 antikoerper, zinc finger DHHC-type containing 24 antikoerper, zinc finger, DHHC domain containing 24 antikoerper, zdhhc24 antikoerper, ZDHHC24 antikoerper, Zdhhc24 antikoerper

Hintergrund: The function of ZDHHC24 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 30 kDa (MW of target protein)