ANO1 Antikörper (Middle Region)

Produktnummer ABIN635577

Produktdetails anti-ANO1 Antikörper

Target: ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM16 A antibody was raised against the middle region of TMEM16

Aufreinigung: Affinity purified

Immunogen: TMEM16 A antibody was raised using the middle region of TMEM16 corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM16A Blocking Peptide, catalog no. 33R-3735, is also available for use as a blocking control in assays to test for specificity of this TMEM16A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANO1

Target: ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))

Andere Bezeichnung: TMEM16A (ANO1 Produkte)

Synonyme: DOG1 antikoerper, ORAOV2 antikoerper, TAOS2 antikoerper, TMEM16A antikoerper, Tmem16a antikoerper, anoctamin 1 antikoerper, anoctamin 1, calcium activated chloride channel antikoerper, Ano1 antikoerper, ANO1 antikoerper

Hintergrund: TMEM16A belongs to the anoctamin family. TMEM16A acts as a calcium-activated chloride channel. It is required for normal tracheal development.

Molekulargewicht: 111 kDa (MW of target protein)