ANO1 Antikörper (Middle Region)
-
- Target Alle ANO1 Antikörper anzeigen
- ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ANO1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM16 A antibody was raised against the middle region of TMEM16
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM16 A antibody was raised using the middle region of TMEM16 corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY
- Top Product
- Discover our top product ANO1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM16A Blocking Peptide, catalog no. 33R-3735, is also available for use as a blocking control in assays to test for specificity of this TMEM16A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANO1 (Anoctamin 1, Calcium Activated Chloride Channel (ANO1))
- Andere Bezeichnung
- TMEM16A (ANO1 Produkte)
- Synonyme
- DOG1 antikoerper, ORAOV2 antikoerper, TAOS2 antikoerper, TMEM16A antikoerper, Tmem16a antikoerper, anoctamin 1 antikoerper, anoctamin 1, calcium activated chloride channel antikoerper, Ano1 antikoerper, ANO1 antikoerper
- Hintergrund
- TMEM16A belongs to the anoctamin family. TMEM16A acts as a calcium-activated chloride channel. It is required for normal tracheal development.
- Molekulargewicht
- 111 kDa (MW of target protein)
-