POMT1 Antikörper (Middle Region)
-
- Target Alle POMT1 Antikörper anzeigen
- POMT1 (Protein-O-Mannosyltransferase 1 (POMT1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser POMT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- POMT1 antibody was raised against the middle region of POMT1
- Aufreinigung
- Affinity purified
- Immunogen
- POMT1 antibody was raised using the middle region of POMT1 corresponding to a region with amino acids LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL
- Top Product
- Discover our top product POMT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POMT1 Blocking Peptide, catalog no. 33R-5473, is also available for use as a blocking control in assays to test for specificity of this POMT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POMT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POMT1 (Protein-O-Mannosyltransferase 1 (POMT1))
- Andere Bezeichnung
- POMT1 (POMT1 Produkte)
- Synonyme
- LGMD2K antikoerper, MDDGA1 antikoerper, MDDGB1 antikoerper, MDDGC1 antikoerper, RT antikoerper, AI505244 antikoerper, protein O-mannosyltransferase 1 antikoerper, protein-O-mannosyltransferase 1 antikoerper, POMT1 antikoerper, Pomt1 antikoerper
- Hintergrund
- POMT1 is an O-mannosyltransferase that requires interaction with the product of the POMT2 gene for enzymatic function. The encoded protein is found in the membrane of the endoplasmic reticulum. Defects in this gene are a cause of Walker-Warburg syndrome (WWS) and limb-girdle muscular dystrophy type 2K (LGMD2K).
- Molekulargewicht
- 82 kDa (MW of target protein)
-