S1PR5 Antikörper (N-Term)
-
- Target Alle S1PR5 Antikörper anzeigen
- S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser S1PR5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- EDG8 antibody was raised against the N terminal of EDG8
- Aufreinigung
- Affinity purified
- Immunogen
- EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI
- Top Product
- Discover our top product S1PR5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EDG8 Blocking Peptide, catalog no. 33R-5959, is also available for use as a blocking control in assays to test for specificity of this EDG8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDG8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))
- Andere Bezeichnung
- EDG8 (S1PR5 Produkte)
- Synonyme
- EDG8 antikoerper, Edg-8 antikoerper, S1P5 antikoerper, SPPR-1 antikoerper, SPPR-2 antikoerper, fd11a07 antikoerper, wu:fd11a07 antikoerper, zgc:92296 antikoerper, edg-8 antikoerper, edg8 antikoerper, s1p5 antikoerper, sppr-1 antikoerper, sppr-2 antikoerper, xts1p5 antikoerper, Edg8 antikoerper, lpB4 antikoerper, zgc:158362 antikoerper, sphingosine-1-phosphate receptor 5 antikoerper, sphingosine-1-phosphate receptor 5a antikoerper, sphingosine-1-phosphate receptor 5b antikoerper, S1PR5 antikoerper, s1pr5a antikoerper, s1pr5 antikoerper, S1pr5 antikoerper, s1pr5b antikoerper
- Hintergrund
- EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.
- Molekulargewicht
- 44 kDa (MW of target protein)
-