-
- Target Alle NTSR1 Antikörper anzeigen
- NTSR1 (Neurotensin Receptor 1 (High Affinity) (NTSR1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NTSR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NTSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT
- Top Product
- Discover our top product NTSR1 Primärantikörper
-
anti-Neurotensin Receptor 1 (High Affinity) (NTSR1) (2nd Extracellular Loop), (AA 209-224) antibody
NTSR1 Reaktivität: Human, Ratte WB, IHC, IF, ICC, FACS, LCI Wirt: Kaninchen Polyclonal unconjugated
anti-Neurotensin Receptor 1 (High Affinity) (NTSR1) (N-Term) antibodyNTSR1 Reaktivität: Human, Affe IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Neurotensin Receptor 1 (High Affinity) (NTSR1) antibodyNTSR1 Reaktivität: Human, Maus WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-Neurotensin Receptor 1 (High Affinity) (NTSR1) (N-Term) antibodyNTSR1 Reaktivität: Human, Maus, Ratte, Meerschweinchen, Pferd, Rind (Kuh), Hund, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Neurotensin Receptor 1 (High Affinity) (NTSR1) (AA 1-67) antibodyNTSR1 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Neurotensin Receptor 1 (High Affinity) (NTSR1) (AA 188-290) antibodyNTSR1 Reaktivität: Human WB, ELISA, IHC (p), IF (cc), IF (p), ICC, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Neurotensin Receptor 1 (High Affinity) (NTSR1) antibodyNTSR1 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Neurotensin Receptor 1 (High Affinity) (NTSR1) (AA 181-230) antibodyNTSR1 Reaktivität: Human, Maus WB, ELISA, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Neurotensin Receptor 1 (High Affinity) (NTSR1) (Internal Region) antibodyNTSR1 Reaktivität: Human, Maus WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Neurotensin Receptor 1 (High Affinity) (NTSR1) (AA 35-84) antibodyNTSR1 Reaktivität: Human, Maus, Meerschweinchen, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NTSR1 Blocking Peptide, catalog no. 33R-2909, is also available for use as a blocking control in assays to test for specificity of this NTSR1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTSR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NTSR1 (Neurotensin Receptor 1 (High Affinity) (NTSR1))
- Andere Bezeichnung
- NTSR1 (NTSR1 Produkte)
- Synonyme
- NTSR1 antikoerper, Ntsr antikoerper, NT-1R antikoerper, NTR-1 antikoerper, NTR1 antikoerper, NTR antikoerper, neurotensin receptor 1 antikoerper, neurotensin receptor 1 (high affinity) antikoerper, NTSR1 antikoerper, Ntsr1 antikoerper
- Hintergrund
- Neurotensin receptor 1 belongs to the large superfamily of G-protein coupled receptors. NTSR1 mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia and antinociception.
- Molekulargewicht
- 46 kDa (MW of target protein)
-
Sie sind hier:
