TPST2 Antikörper (Middle Region)

Produktnummer ABIN635521

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TPST2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für TPST2 Antikörper (Middle Region) (ABIN635521)

Target: TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPST2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TPST2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TPST2 antibody was raised against the middle region of TPST2

Aufreinigung: Affinity purified

Immunogen: TPST2 antibody was raised using the middle region of TPST2 corresponding to a region with amino acids KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TPST2 Blocking Peptide, (ABIN939631), is also available for use as a blocking control in assays to test for specificity of this TPST2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPST2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPST2

Target: TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))

Andere Bezeichnung: TPST2

Hintergrund: TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.

Molekulargewicht: 42 kDa (MW of target protein)