TPST2 Antikörper (Middle Region)
-
- Target Alle TPST2 Antikörper anzeigen
- TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TPST2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TPST2 antibody was raised against the middle region of TPST2
- Aufreinigung
- Affinity purified
- Immunogen
- TPST2 antibody was raised using the middle region of TPST2 corresponding to a region with amino acids KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL
- Top Product
- Discover our top product TPST2 Primärantikörper
-
anti-tyrosylprotein Sulfotransferase 2 (TPST2) (AA 26-377) antibody
TPST2 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-tyrosylprotein Sulfotransferase 2 (TPST2) (C-Term) antibodyTPST2 Reaktivität: Human ELISA, WB Wirt: Kaninchen Polyclonal unconjugated
anti-tyrosylprotein Sulfotransferase 2 (TPST2) (AA 328-358), (C-Term) antibodyTPST2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB4954 unconjugated
anti-tyrosylprotein Sulfotransferase 2 (TPST2) (AA 216-265) antibodyTPST2 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hund, Meerschweinchen, Pferd, Fledermaus, Huhn, Drosophila melanogaster, Hamster, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-tyrosylprotein Sulfotransferase 2 (TPST2) (Middle Region) antibodyTPST2 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hund, Meerschweinchen, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TPST2 Blocking Peptide, catalog no. 33R-4245, is also available for use as a blocking control in assays to test for specificity of this TPST2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPST2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))
- Andere Bezeichnung
- TPST2 (TPST2 Produkte)
- Synonyme
- zgc:64196 antikoerper, AI448750 antikoerper, D5Ucla3 antikoerper, Tango13b antikoerper, grm antikoerper, grt antikoerper, TANGO13B antikoerper, tyrosylprotein sulfotransferase 2 antikoerper, tyrosylprotein sulfotransferase 2 L homeolog antikoerper, protein-tyrosine sulfotransferase 2 antikoerper, tpst2 antikoerper, TPST2 antikoerper, tpst2.L antikoerper, Tpst2 antikoerper
- Hintergrund
- TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.
- Molekulargewicht
- 42 kDa (MW of target protein)
-
