ODF4 Antikörper (N-Term)
-
- Target Alle ODF4 Antikörper anzeigen
- ODF4 (Outer Dense Fiber of Sperm Tails 4 (ODF4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ODF4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ODF4 antibody was raised against the N terminal of ODF4
- Aufreinigung
- Affinity purified
- Immunogen
- ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL
- Top Product
- Discover our top product ODF4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ODF4 Blocking Peptide, catalog no. 33R-5819, is also available for use as a blocking control in assays to test for specificity of this ODF4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ODF4 (Outer Dense Fiber of Sperm Tails 4 (ODF4))
- Andere Bezeichnung
- ODF4 (ODF4 Produkte)
- Synonyme
- CT134 antikoerper, CT136 antikoerper, OPPO1 antikoerper, Oppo1 antikoerper, outer dense fiber of sperm tails 4 antikoerper, ODF4 antikoerper, Odf4 antikoerper
- Hintergrund
- ODF4 is the component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.
- Molekulargewicht
- 29 kDa (MW of target protein)
-