LOC729185 (N-Term) Antikörper

Produktnummer ABIN635513

Produktdetails

Target: LOC729185

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Spezifität: LOC729185 antibody was raised against the N terminal Of Loc729185

Aufreinigung: Affinity purified

Immunogen: LOC729185 antibody was raised using the N terminal Of Loc729185 corresponding to a region with amino acids VSGDRRVRSRHAKVGTLGDREAILQRLDHLEEVVYNQLNGLAKPIGLVEG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC729185 Blocking Peptide, catalog no. 33R-9806, is also available for use as a blocking control in assays to test for specificity of this LOC729185 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC729185 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: LOC729185

Hintergrund: The exact function of LOC729185 is not known.

Molekulargewicht: 41 kDa (MW of target protein)