PIGW Antikörper (Middle Region)

Produktnummer ABIN635512

Produktdetails anti-PIGW Antikörper

Target: PIGW (Phosphatidylinositol Glycan W (PIGW))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIGW Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIGW antibody was raised against the middle region of PIGW

Aufreinigung: Affinity purified

Immunogen: PIGW antibody was raised using the middle region of PIGW corresponding to a region with amino acids IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIGW Blocking Peptide, catalog no. 33R-3893, is also available for use as a blocking control in assays to test for specificity of this PIGW antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGW antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIGW

Target: PIGW (Phosphatidylinositol Glycan W (PIGW))

Andere Bezeichnung: PIGW (PIGW Produkte)

Synonyme: Gwt1 antikoerper, PIG-W antikoerper, 2610044A17Rik antikoerper, phosphatidylinositol glycan anchor biosynthesis class W antikoerper, phosphatidylinositol glycan anchor biosynthesis, class W antikoerper, PIGW antikoerper, Pigw antikoerper

Hintergrund: Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Inositol Metabolic Process