SLC17A3 Antikörper
-
- Target Alle SLC17A3 Antikörper anzeigen
- SLC17A3 (Solute Carrier Family 17 (Anion/Sugar Transporter), Member 3 (SLC17A3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC17A3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC17 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWS
- Top Product
- Discover our top product SLC17A3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC17A3 Blocking Peptide, catalog no. 33R-3125, is also available for use as a blocking control in assays to test for specificity of this SLC17A3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC17A3 (Solute Carrier Family 17 (Anion/Sugar Transporter), Member 3 (SLC17A3))
- Andere Bezeichnung
- SLC17A3 (SLC17A3 Produkte)
- Synonyme
- AW261723 antikoerper, Npt4 antikoerper, Rnpt4 antikoerper, SLC17A3 antikoerper, NPT4 antikoerper, solute carrier family 17 member 3 antikoerper, solute carrier family 17 (sodium phosphate), member 3 antikoerper, SLC17A3 antikoerper, Slc17a3 antikoerper
- Hintergrund
- SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport.
- Molekulargewicht
- 46 kDa (MW of target protein)
-