NAT8B Antikörper
-
- Target Alle NAT8B Antikörper anzeigen
- NAT8B (N-Acetyltransferase 8B (GCN5-Related, Putative, Gene/pseudogene) (NAT8B))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NAT8B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NAT8 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA
- Top Product
- Discover our top product NAT8B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NAT8B Blocking Peptide, catalog no. 33R-8328, is also available for use as a blocking control in assays to test for specificity of this NAT8B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAT8B (N-Acetyltransferase 8B (GCN5-Related, Putative, Gene/pseudogene) (NAT8B))
- Andere Bezeichnung
- NAT8B (NAT8B Produkte)
- Synonyme
- EG434057 antikoerper, Cml1 antikoerper, Cml6 antikoerper, Nat8 antikoerper, RGD621605 antikoerper, CML2 antikoerper, Hcml2 antikoerper, NAT8BP antikoerper, N-acetyltransferase 8B antikoerper, N-acetyltransferase 8B, pseudogene antikoerper, N-acetyltransferase 8B (putative, gene/pseudogene) antikoerper, NAT8B antikoerper, Nat8b-ps antikoerper, Nat8b antikoerper
- Hintergrund
- The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance.
- Molekulargewicht
- 25 kDa (MW of target protein)
-