NAT8B Antikörper

Produktnummer ABIN635506

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch NAT8B in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für NAT8B Antikörper (ABIN635506)

Target: NAT8B (N-Acetyltransferase 8B (GCN5-Related, Putative, Gene/pseudogene) (NAT8B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAT8B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NAT8B Antikörper

Aufreinigung: Affinity purified

Immunogen: NAT8 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NAT8B Blocking Peptide, (ABIN5614920), is also available for use as a blocking control in assays to test for specificity of this NAT8B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NAT8B

Target: NAT8B (N-Acetyltransferase 8B (GCN5-Related, Putative, Gene/pseudogene) (NAT8B))

Andere Bezeichnung: NAT8B

Hintergrund: The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance.

Molekulargewicht: 25 kDa (MW of target protein)