ATP10D Antikörper (C-Term)

Produktnummer ABIN635469

Produktdetails anti-ATP10D Antikörper

Target: ATP10D (ATPase, Class V, Type 10D (ATP10D))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP10D Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP10 D antibody was raised against the C terminal of ATP10

Aufreinigung: Affinity purified

Immunogen: ATP10 D antibody was raised using the C terminal of ATP10 corresponding to a region with amino acids LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP10D Blocking Peptide, catalog no. 33R-4952, is also available for use as a blocking control in assays to test for specificity of this ATP10D antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP10D

Target: ATP10D (ATPase, Class V, Type 10D (ATP10D))

Andere Bezeichnung: ATP10D (ATP10D Produkte)

Synonyme: ATP10D antikoerper, atp10d antikoerper, MGC185750 antikoerper, ATPVD antikoerper, 9830145H18Rik antikoerper, D5Buc24e antikoerper, ATPase phospholipid transporting 10D (putative) antikoerper, ATPase, class V, type 10D antikoerper, ATP10D antikoerper, atp10d antikoerper, Atp10d antikoerper

Hintergrund: ATP10D is a multi-pass membrane protein. It belongs to the cation transport ATPase (P-type) family, type IV subfamily. The exact function of ATP10D remains unknown.

Molekulargewicht: 160 kDa (MW of target protein)