TMEM38B Antikörper (C-Term)

Produktnummer ABIN635460

Produktdetails anti-TMEM38B Antikörper

Target: TMEM38B (Transmembrane Protein 38B (TMEM38B))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM38B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM38 B antibody was raised against the C terminal of TMEM38

Aufreinigung: Affinity purified

Immunogen: TMEM38 B antibody was raised using the C terminal of TMEM38 corresponding to a region with amino acids WMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM38B Blocking Peptide, catalog no. 33R-9980, is also available for use as a blocking control in assays to test for specificity of this TMEM38B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM38B

Target: TMEM38B (Transmembrane Protein 38B (TMEM38B))

Andere Bezeichnung: TMEM38B (TMEM38B Produkte)

Synonyme: zgc:55815 antikoerper, tricb antikoerper, tric-b antikoerper, MGC83592 antikoerper, DKFZp469C0220 antikoerper, C9orf87 antikoerper, D4Ertd89e antikoerper, OI14 antikoerper, TRIC-B antikoerper, TRICB antikoerper, bA219P18.1 antikoerper, 1600017F22Rik antikoerper, AA437809 antikoerper, AV051057 antikoerper, mg33b antikoerper, RGD1305703 antikoerper, transmembrane protein 38B antikoerper, transmembrane protein 38B L homeolog antikoerper, tmem38b antikoerper, TMEM38B antikoerper, tmem38b.L antikoerper, Tmem38b antikoerper

Hintergrund: TMEM38B is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.

Molekulargewicht: 32 kDa (MW of target protein)