TMEM38B Antikörper (C-Term)

Produktnummer ABIN635460

Der Kaninchen Polyklonal anti-TMEM38B Antikörper (ABIN635460) detektiert spezifisch TMEM38B in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TMEM38B Antikörper (C-Term) (ABIN635460)

Target: TMEM38B (Transmembrane Protein 38B (TMEM38B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM38B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM38B Antikörper

Bindungsspezifität: C-Term

Spezifität: TMEM38 B antibody was raised against the C terminal of TMEM38

Aufreinigung: Affinity purified

Immunogen: TMEM38 B antibody was raised using the C terminal of TMEM38 corresponding to a region with amino acids WMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM38B Blocking Peptide, (ABIN5616679), is also available for use as a blocking control in assays to test for specificity of this TMEM38B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM38B

Target: TMEM38B (Transmembrane Protein 38B (TMEM38B))

Andere Bezeichnung: TMEM38B

Hintergrund: TMEM38B is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.

Molekulargewicht: 32 kDa (MW of target protein)