CHIC2 Antikörper (N-Term)
-
- Target Alle CHIC2 Antikörper anzeigen
- CHIC2 (Cysteine-Rich Hydrophobic Domain 2 (CHIC2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHIC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CHIC2 antibody was raised against the N terminal of CHIC2
- Aufreinigung
- Affinity purified
- Immunogen
- CHIC2 antibody was raised using the N terminal of CHIC2 corresponding to a region with amino acids MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESE
- Top Product
- Discover our top product CHIC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHIC2 Blocking Peptide, catalog no. 33R-5620, is also available for use as a blocking control in assays to test for specificity of this CHIC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHIC2 (Cysteine-Rich Hydrophobic Domain 2 (CHIC2))
- Andere Bezeichnung
- CHIC2 (CHIC2 Produkte)
- Synonyme
- zgc:55670 antikoerper, BTL antikoerper, 1700081B18Rik antikoerper, 4930502K01Rik antikoerper, cysteine rich hydrophobic domain 2 antikoerper, cysteine-rich hydrophobic domain 2 antikoerper, cysteine rich hydrophobic domain 2 S homeolog antikoerper, CHIC2 antikoerper, CpipJ_CPIJ013126 antikoerper, chic2 antikoerper, chic2.S antikoerper, Chic2 antikoerper
- Hintergrund
- CHIC2 is a member of the CHIC family of proteins. This protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. CHIC2 gene is associated with some cases of acute myeloid leukemia.
- Molekulargewicht
- 19 kDa (MW of target protein)
-