SEMA4F Antikörper (N-Term)
-
- Target Alle SEMA4F Antikörper anzeigen
- SEMA4F (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4F (SEMA4F))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SEMA4F Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SEMA4 F antibody was raised against N terminal of SEMA4
- Aufreinigung
- Affinity purified
- Immunogen
- SEMA4 F antibody was raised using the N terminal of SEMA4 corresponding to a region with amino acids PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
- Top Product
- Discover our top product SEMA4F Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SEMA4F Blocking Peptide, catalog no. 33R-7086, is also available for use as a blocking control in assays to test for specificity of this SEMA4F antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEMA4F (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4F (SEMA4F))
- Andere Bezeichnung
- SEMA4F (SEMA4F Produkte)
- Synonyme
- M-SEMA antikoerper, PRO2353 antikoerper, S4F antikoerper, SEMAM antikoerper, SEMAW antikoerper, m-Sema-M antikoerper, ssemaphorin 4F antikoerper, sema domain, immunoglobulin domain (Ig), TM domain, and short cytoplasmic domain antikoerper, SEMA4F antikoerper, Sema4f antikoerper
- Hintergrund
- SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
- Molekulargewicht
- 67 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-