LOC728864 (N-Term) Antikörper

Produktnummer ABIN635424

Produktdetails

Target: LOC728864

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LOC728864 antibody was raised against the N terminal Of Loc728864

Aufreinigung: Affinity purified

Immunogen: LOC728864 antibody was raised using the N terminal Of Loc728864 corresponding to a region with amino acids MAPLPTSHPSQAQDPHSWPCSPPHTPTKSRTHAHGPAPHLTPQPSPGPTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC728864 Blocking Peptide, catalog no. 33R-5712, is also available for use as a blocking control in assays to test for specificity of this LOC728864 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC728864 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: LOC728864

Hintergrund: The function of LOC728864 remains unkonwn.

Molekulargewicht: 22 kDa (MW of target protein)