Ribophorin II Antikörper (Middle Region)

Produktnummer ABIN635418

Produktdetails anti-Ribophorin II Antikörper

Target: Ribophorin II (RPN2)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ribophorin II Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Ribophorin II antibody was raised against the middle region of RPN2

Aufreinigung: Affinity purified

Immunogen: Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ribophorin II Blocking Peptide, catalog no. 33R-4018, is also available for use as a blocking control in assays to test for specificity of this Ribophorin II antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Ribophorin II

Target: Ribophorin II (RPN2)

Andere Bezeichnung: Ribophorin II (RPN2 Produkte)

Synonyme: RIBIIR antikoerper, RPN-II antikoerper, RPNII antikoerper, SWP1 antikoerper, RPN2 antikoerper, 1300012C06Rik antikoerper, AV261018 antikoerper, Rpn-2 antikoerper, fb95d11 antikoerper, fj62b10 antikoerper, wu:fb61f08 antikoerper, wu:fb74e07 antikoerper, wu:fb95d11 antikoerper, wu:fj41f11 antikoerper, wu:fj62b10 antikoerper, rpn2 antikoerper, ribophorin II antikoerper, dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 antikoerper, ribophorin II S homeolog antikoerper, RPN2 antikoerper, Rpn2 antikoerper, rpn2 antikoerper, LOC5579328 antikoerper, Bm1_30625 antikoerper, rpn2.S antikoerper

Hintergrund: RPN2 is a type I integral membrane protein found only in the rough endoplasmic reticulum.

Molekulargewicht: 67 kDa (MW of target protein)