PPP1R3A Antikörper
-
- Target Alle PPP1R3A Antikörper anzeigen
- PPP1R3A (Protein Phosphatase 1, Regulatory Subunit 3A (PPP1R3A))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPP1R3A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PPP1 R1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE
- Top Product
- Discover our top product PPP1R3A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPP1R3A Blocking Peptide, catalog no. 33R-5946, is also available for use as a blocking control in assays to test for specificity of this PPP1R3A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP1R3A (Protein Phosphatase 1, Regulatory Subunit 3A (PPP1R3A))
- Andere Bezeichnung
- PPP1R3A (PPP1R3A Produkte)
- Synonyme
- GM antikoerper, RG1 antikoerper, RGL antikoerper, PP1G antikoerper, PPP1R3 antikoerper, PPP1R3A antikoerper, protein phosphatase 1, regulatory (inhibitor) subunit 3A antikoerper, protein phosphatase 1 regulatory subunit 3A antikoerper, Ppp1r3a antikoerper, PPP1R3A antikoerper
- Hintergrund
- The glycogen-associated form of protein phosphatase-1 (PP1) derived from skeletal muscle is a heterodimer composed of a 37 kDa catalytic subunit and a 124 kDa targeting and regulatory subunit.
- Molekulargewicht
- 126 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-