Integrin beta 5 Antikörper (Middle Region)

Produktnummer ABIN635415

Produktdetails anti-Integrin beta 5 Antikörper

Target: Integrin beta 5 (ITGB5)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Integrin beta 5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Integrin Beta 5 antibody was raised against the middle region of ITGB5

Aufreinigung: Affinity purified

Immunogen: Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Integrin Beta 5 Blocking Peptide, catalog no. 33R-4936, is also available for use as a blocking control in assays to test for specificity of this Integrin Beta 5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Integrin beta 5

Target: Integrin beta 5 (ITGB5)

Andere Bezeichnung: Integrin beta 5 (ITGB5 Produkte)

Synonyme: ITGB5 antikoerper, AA475909 antikoerper, AI874634 antikoerper, ESTM23 antikoerper, [b]-5 antikoerper, [b]5 antikoerper, [b]5A antikoerper, [b]5B antikoerper, beta-5 antikoerper, beta5 antikoerper, RGD1563276 antikoerper, integrin, beta 5 antikoerper, integrin beta 5 antikoerper, integrin subunit beta 5 antikoerper, ITGB5 antikoerper, Itgb5 antikoerper

Hintergrund: Integrin alpha-V/beta-5 is a receptor for fibronectin. It recognises the sequence R-G-D in its ligand.

Molekulargewicht: 88 kDa (MW of target protein)

Pathways: Integrin Complex