SPINT1 Antikörper (Middle Region)

Produktnummer ABIN635406

Produktdetails anti-SPINT1 Antikörper

Target: SPINT1 (serine Peptidase Inhibitor, Kunitz Type 1 (SPINT1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPINT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SPINT1 antibody was raised against the middle region of SPINT1

Aufreinigung: Affinity purified

Immunogen: SPINT1 antibody was raised using the middle region of SPINT1 corresponding to a region with amino acids PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPINT1 Blocking Peptide, catalog no. 33R-7084, is also available for use as a blocking control in assays to test for specificity of this SPINT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPINT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPINT1

Target: SPINT1 (serine Peptidase Inhibitor, Kunitz Type 1 (SPINT1))

Andere Bezeichnung: SPINT1 (SPINT1 Produkte)

Synonyme: HAI-1 antikoerper, HAI antikoerper, HAI1 antikoerper, MANSC2 antikoerper, cb376 antikoerper, sb:cb376 antikoerper, spint1l antikoerper, zgc:64075 antikoerper, serine peptidase inhibitor, Kunitz type 1 antikoerper, serine protease inhibitor, Kunitz type 1 antikoerper, serine peptidase inhibitor, Kunitz type 1 b antikoerper, serine peptidase inhibitor, Kunitz type 1 a antikoerper, SPINT1 antikoerper, Spint1 antikoerper, spint1b antikoerper, spint1a antikoerper

Hintergrund: The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF.

Molekulargewicht: 53 kDa (MW of target protein)