SLC24A4 Antikörper
-
- Target Alle SLC24A4 (Slc24a4) Antikörper anzeigen
- SLC24A4 (Slc24a4) (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 4 (Slc24a4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC24A4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC24 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTI
- Top Product
- Discover our top product Slc24a4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC24A4 Blocking Peptide, catalog no. 33R-7357, is also available for use as a blocking control in assays to test for specificity of this SLC24A4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC24A4 (Slc24a4) (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 4 (Slc24a4))
- Andere Bezeichnung
- SLC24A4 (Slc24a4 Produkte)
- Synonyme
- NCKX4 antikoerper, SHEP6 antikoerper, SLC24A2 antikoerper, A930002M03Rik antikoerper, AW492432 antikoerper, Nckx4 antikoerper, solute carrier family 24 member 4 antikoerper, solute carrier family 24 (sodium/potassium/calcium exchanger), member 4 antikoerper, SLC24A4 antikoerper, Slc24a4 antikoerper
- Hintergrund
- Potassium-dependent sodium/calcium exchangers, such as NCKX4, are thought to transport 1 intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions.
- Molekulargewicht
- 65 kDa (MW of target protein)
-