NHE8 Antikörper
-
- Target Alle NHE8 (SLC9A8) Antikörper anzeigen
- NHE8 (SLC9A8) (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NHE8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC9 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL
- Top Product
- Discover our top product SLC9A8 Primärantikörper
-
anti-Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8) (C-Term) antibody
SLC9A8 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8) (C-Term) antibodySLC9A8 Reaktivität: Human WB Wirt: Maus Monoclonal 7A11 unconjugated
anti-Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8) (C-Term) antibodySLC9A8 Reaktivität: Human, Affe WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8) (C-Term) antibodySLC9A8 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8) (C-Term) antibodySLC9A8 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8) (C-Term) antibodySLC9A8 Reaktivität: Human, Maus, Ratte, Kaninchen, Hund, Meerschweinchen, Pferd, Affe, Huhn, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8) (AA 451-500) antibodySLC9A8 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8) (N-Term) antibodySLC9A8 Reaktivität: Human, Maus, Ratte, Kaninchen, Hund, Meerschweinchen, Pferd, Zebrafisch (Danio rerio), Rind (Kuh), Saccharomyces cerevisiae WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC9A8 Blocking Peptide, catalog no. 33R-1315, is also available for use as a blocking control in assays to test for specificity of this SLC9A8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NHE8 (SLC9A8) (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8))
- Andere Bezeichnung
- SLC9A8 (SLC9A8 Produkte)
- Synonyme
- 1200006P13Rik antikoerper, 6430709P13Rik antikoerper, AI182282 antikoerper, NHE8 antikoerper, nhe8 antikoerper, wu:fj61b02 antikoerper, zgc:103660 antikoerper, NHE-8 antikoerper, solute carrier family 9 member A8 antikoerper, solute carrier family 9 member 8 antikoerper, solute carrier family 9 (sodium/hydrogen exchanger), member 8 antikoerper, solute carrier family 9, subfamily A (NHE8, cation proton antiporter 8), member 8 antikoerper, SLC9A8 antikoerper, slc9a8 antikoerper, Slc9a8 antikoerper
- Hintergrund
- Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHEs have multiple functions, including intracellular pH homeostasis, cell volume regulation, and electroneutral NaCl absorption in epithelia.
- Molekulargewicht
- 65 kDa (MW of target protein)
- Pathways
- Proton Transport
-
