SLC7A2 Antikörper
-
- Target Alle SLC7A2 Antikörper anzeigen
- SLC7A2 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 2 (SLC7A2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC7A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC7 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
- Top Product
- Discover our top product SLC7A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC7A2 Blocking Peptide, catalog no. 33R-9430, is also available for use as a blocking control in assays to test for specificity of this SLC7A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A2 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 2 (SLC7A2))
- Andere Bezeichnung
- SLC7A2 (SLC7A2 Produkte)
- Synonyme
- slc7a2 antikoerper, CAT2 antikoerper, CAT-2 antikoerper, MGC83504 antikoerper, zgc:103686 antikoerper, ATRC2 antikoerper, HCAT2 antikoerper, AI158848 antikoerper, Atrc2 antikoerper, Cat2 antikoerper, Tea antikoerper, Cat2a antikoerper, Cat2b antikoerper, RCAT2 antikoerper, cCAT-2 antikoerper, solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, gene 2 L homeolog antikoerper, solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 antikoerper, solute carrier family 7 member 2 antikoerper, slc7a2.2.L antikoerper, slc7a2 antikoerper, SLC7A2 antikoerper, Slc7a2 antikoerper
- Hintergrund
- SLC7A2 is a low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). SLC7A2 plays a regulatory role in classical or alternative activation of macrophages.
- Molekulargewicht
- 72 kDa (MW of target protein)
-