ATP1B4 Antikörper
-
- Target Alle ATP1B4 Antikörper anzeigen
- ATP1B4 (ATPase, Na+/K+ Transporting, beta 4 Polypeptide (ATP1B4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATP1B4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ATP1 B4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS
- Top Product
- Discover our top product ATP1B4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ATP1B4 Blocking Peptide, catalog no. 33R-1078, is also available for use as a blocking control in assays to test for specificity of this ATP1B4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP1B4 (ATPase, Na+/K+ Transporting, beta 4 Polypeptide (ATP1B4))
- Andere Bezeichnung
- ATP1B4 (ATP1B4 Produkte)
- Synonyme
- 1110020B02Rik antikoerper, Ac2-628 antikoerper, ATPase, (Na+)/K+ transporting, beta 4 polypeptide antikoerper, ATPase Na+/K+ transporting family member beta 4 antikoerper, ATPase, Na+/K+ transporting, beta 4 polypeptide L homeolog antikoerper, Atp1b4 antikoerper, ATP1B4 antikoerper, atp1b4.L antikoerper
- Hintergrund
- This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis, Proton Transport
-