ATP1B4 Antikörper

Produktnummer ABIN635356

Produktdetails anti-ATP1B4 Antikörper

Target: ATP1B4 (ATPase, Na+/K+ Transporting, beta 4 Polypeptide (ATP1B4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP1B4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ATP1 B4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP1B4 Blocking Peptide, catalog no. 33R-1078, is also available for use as a blocking control in assays to test for specificity of this ATP1B4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP1B4

Target: ATP1B4 (ATPase, Na+/K+ Transporting, beta 4 Polypeptide (ATP1B4))

Andere Bezeichnung: ATP1B4 (ATP1B4 Produkte)

Synonyme: 1110020B02Rik antikoerper, Ac2-628 antikoerper, ATPase, (Na+)/K+ transporting, beta 4 polypeptide antikoerper, ATPase Na+/K+ transporting family member beta 4 antikoerper, ATPase, Na+/K+ transporting, beta 4 polypeptide L homeolog antikoerper, Atp1b4 antikoerper, ATP1B4 antikoerper, atp1b4.L antikoerper

Hintergrund: This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Proton Transport