B4GALT2 Antikörper (Middle Region)
-
- Target Alle B4GALT2 Antikörper anzeigen
- B4GALT2 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 2 (B4GALT2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser B4GALT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- B4 GALT2 antibody was raised against the middle region of B4 ALT2
- Aufreinigung
- Affinity purified
- Immunogen
- B4 GALT2 antibody was raised using the middle region of B4 ALT2 corresponding to a region with amino acids RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH
- Top Product
- Discover our top product B4GALT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
B4GALT2 Blocking Peptide, catalog no. 33R-8039, is also available for use as a blocking control in assays to test for specificity of this B4GALT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B4GALT2 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 2 (B4GALT2))
- Andere Bezeichnung
- B4GALT2 (B4GALT2 Produkte)
- Synonyme
- B4Gal-T2 antikoerper, B4Gal-T3 antikoerper, beta4Gal-T2 antikoerper, Ggtb2 antikoerper, b4gal-t1 antikoerper, b4galt2 antikoerper, beta4gal-t1 antikoerper, cdg2d antikoerper, ggtb2 antikoerper, gt1 antikoerper, gtb antikoerper, b4gal-t2 antikoerper, beta4gal-t2 antikoerper, b4Gal-T2 antikoerper, si:ch211-261p7.4 antikoerper, CKII antikoerper, beta-1,4-galactosyltransferase 2 antikoerper, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 antikoerper, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1, gene 2 antikoerper, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 S homeolog antikoerper, B4GALT2 antikoerper, B4galt2 antikoerper, b4galt1.2 antikoerper, b4galt2.S antikoerper, b4galt2 antikoerper
- Hintergrund
- This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose, all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-